Lineage for d6kuzc1 (6kuz C:3-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384843Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries)
  8. 2384887Domain d6kuzc1: 6kuz C:3-219 [388869]
    Other proteins in same PDB: d6kuza2, d6kuza3, d6kuza4, d6kuza5, d6kuzb2, d6kuzb3, d6kuzb4, d6kuzb5, d6kuzc2, d6kuzc3, d6kuzc4, d6kuzc5, d6kuzd2, d6kuzd3, d6kuzd4, d6kuzd5
    automated match to d1f4ha3
    complexed with dms, dvl, gol, mg, na

Details for d6kuzc1

PDB Entry: 6kuz (more details), 2.83 Å

PDB Description: e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksl01
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d6kuzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kuzc1 b.18.1.0 (C:3-219) automated matches {Escherichia coli [TaxId: 83333]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d6kuzc1:

Click to download the PDB-style file with coordinates for d6kuzc1.
(The format of our PDB-style files is described here.)

Timeline for d6kuzc1: