Lineage for d6l40i_ (6l40 I:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460579Protein Clp protease, ClpP subunit [52098] (10 species)
  7. 2460779Species Staphylococcus aureus [TaxId:273036] [388880] (1 PDB entry)
  8. 2460788Domain d6l40i_: 6l40 I: [388881]
    automated match to d3st9f_
    complexed with fn3

Details for d6l40i_

PDB Entry: 6l40 (more details), 2.21 Å

PDB Description: discovery of novel peptidomimetic boronate clpp inhibitors with noncanonical enzyme mechanism as potent virulence blockers in vitro and in vivo
PDB Compounds: (I:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6l40i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l40i_ c.14.1.1 (I:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 273036]}
diysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfaiy
dtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqateiei
aanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvpe

SCOPe Domain Coordinates for d6l40i_:

Click to download the PDB-style file with coordinates for d6l40i_.
(The format of our PDB-style files is described here.)

Timeline for d6l40i_: