SCOPe 2.08: Domain d6xdha2: 6xdh A:192-346

Lineage for d6xdha2 (6xdh A:192-346)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.0: automated matches [356574] (1 protein)
   not a true family

6. Protein automated matches [356575] (3 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382219] (7 PDB entries)

8. Domain d6xdha2: 6xdh A:192-346 [388089]
   Other proteins in same PDB: d6xdha1, d6xdha3, d6xdhb1, d6xdhb3
   automated match to d2h85a2
   complexed with act, cit, edo, fmt

Details for d6xdha2

PDB Entry: 6xdh, 2.35 Å

PDB Description: crystal structure of nendou (uridylate-specific endoribonuclease, nsp15) from betacoronavirus sars-cov-2

PDB Compounds: (A:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d6xdha2:

Sequence; same for both SEQRES and ATOM records:

>d6xdha2 d.294.1.0 (A:192-346) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl
liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsvvskvvkvtidyteisfmlwckdghvetfypkl

Timeline for d6xdha2:

• d6xdha2 first appeared in SCOPe 2.07