SCOPe 2.06: Domain d1ah5a2: 1ah5 A:220-313

Lineage for d1ah5a2 (1ah5 A:220-313)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families)
   automatically mapped to Pfam PF03900

5. Family d.50.2.1: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54783] (1 protein)

6. Protein Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54784] (1 species)

7. Species Escherichia coli [TaxId:562] [54785] (5 PDB entries)

8. Domain d1ah5a2: 1ah5 A:220-313 [38795]
   Other proteins in same PDB: d1ah5a1
   complexed with dpm

Details for d1ah5a2

PDB Entry: 1ah5, 2.4 Å

PDB Description: reduced form selenomethionine-labelled hydroxymethylbilane synthase determined by mad

PDB Compounds: (A:) hydroxymethylbilane synthase

SCOPe Domain Sequences for d1ah5a2:

Sequence; same for both SEQRES and ATOM records:

>d1ah5a2 d.50.2.1 (A:220-313) Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain {Escherichia coli [TaxId: 562]}
nhhetalrvtaeramntrleggcqvpigsyaelidgeiwlralvgapdgsqiirgerrga
pqdaeqmgislaeellnngareilaevyngdapa

Timeline for d1ah5a2:

• d1ah5a2 first appeared (with stable ids) in SCOP 1.55, called d1ah5_2
  
• d1ah5a2 appears in SCOPe 2.05
  
• d1ah5a2 appears in SCOPe 2.07
  
• d1ah5a2 appears in the current release, SCOPe 2.08