Lineage for d6p9id1 (6p9i D:1-111)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355554Domain d6p9id1: 6p9i D:1-111 [387791]
    Other proteins in same PDB: d6p9ib2, d6p9id2
    automated match to d2mcg11

Details for d6p9id1

PDB Entry: 6p9i (more details), 2.4 Å

PDB Description: crystal structure of human anti staphylococcus aureus antibody stau- 399 fab
PDB Compounds: (D:) human anti staphylococcus aureus antibody STAU-399 Fab light chain

SCOPe Domain Sequences for d6p9id1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p9id1 b.1.1.1 (D:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqprsvsgspgqsvtisctgtsndvgyydhvswyqqhpgkapkfiiydvskrpsgv
pdrfsgsksdntasltisglqaedeadyyccsfagsytyvfgtgtkvtvlg

SCOPe Domain Coordinates for d6p9id1:

Click to download the PDB-style file with coordinates for d6p9id1.
(The format of our PDB-style files is described here.)

Timeline for d6p9id1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6p9id2