Lineage for d1dd3b2 (1dd3 B:58-128)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190278Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 2190279Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 2190280Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein)
    automatically mapped to Pfam PF00542
  6. 2190281Protein Ribosomal protein L7/12, C-terminal domain [54738] (3 species)
  7. 2190296Species Thermotoga maritima [TaxId:2336] [54740] (3 PDB entries)
  8. 2190298Domain d1dd3b2: 1dd3 B:58-128 [38761]
    Other proteins in same PDB: d1dd3a1, d1dd3b1, d1dd3c_, d1dd3d_

Details for d1dd3b2

PDB Entry: 1dd3 (more details), 2 Å

PDB Description: crystal structure of ribosomal protein l12 from thermotoga maritima
PDB Compounds: (B:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1dd3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd3b2 d.45.1.1 (B:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
efdvvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkk
leeagaevelk

SCOPe Domain Coordinates for d1dd3b2:

Click to download the PDB-style file with coordinates for d1dd3b2.
(The format of our PDB-style files is described here.)

Timeline for d1dd3b2: