Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
Species Aquifex pyrophilus [TaxId:2714] [54729] (1 PDB entry) |
Domain d1coja2: 1coj A:91-212 [38734] Other proteins in same PDB: d1coja1 complexed with fe |
PDB Entry: 1coj (more details), 1.9 Å
SCOPe Domain Sequences for d1coja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} ggkgepsealkkkieediggldactnelkaaamafrgwailgldifsgrlvvngldahnv ynltgliplividtyehayyvdyknkrppyidaffkninwdvvnerfekamkayealkdf ik
Timeline for d1coja2: