Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
Protein Fe superoxide dismutase (FeSOD) [46611] (10 species) |
Species Aquifex pyrophilus [TaxId:2714] [46615] (1 PDB entry) |
Domain d1coja1: 1coj A:2-90 [15737] Other proteins in same PDB: d1coja2 complexed with fe |
PDB Entry: 1coj (more details), 1.9 Å
SCOPe Domain Sequences for d1coja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1coja1 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} vhklepkdhlkpqnlegisneqiephfeahykgyvakyneiqekladqnfadrskanqny seyrelkveetfnymgvvlhelyfgmltp
Timeline for d1coja1: