SCOPe 2.08: Domain d6ra9a1: 6ra9 A:5-242

Lineage for d6ra9a1 (6ra9 A:5-242)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [259156] (2 PDB entries)

8. Domain d6ra9a1: 6ra9 A:5-242 [386887]
   Other proteins in same PDB: d6ra9a2, d6ra9a3, d6ra9b2, d6ra9b3
   automated match to d4c0sa1
   complexed with gdp, gol, gpe, pok, so4

Details for d6ra9a1

PDB Entry: 6ra9, 2.7 Å

PDB Description: novel structural features and post-translational modifications in eukaryotic elongation factor 1a2 from oryctolagus cuniculus

PDB Compounds: (A:) Elongation factor 1-alpha 2

SCOPe Domain Sequences for d6ra9a1:

Sequence; same for both SEQRES and ATOM records:

>d6ra9a1 c.37.1.0 (A:5-242) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
kthinivvighvdsgkstttghliykcggidkrtiekfekeaaemgkgsfkyawvldklk
aerergitidislwkfettkyyitiidapghrdfiknmitgtsqadcavlivaagvgefe
agiskngqtrehallaytlgvkqlivgvnkmdstepaysekrydeivkevsayikkigyn
patvpfvpisgwhgdnmlepspnmpwfkgwkverkegnasgvsllealdtilpptrpt

Timeline for d6ra9a1:

• d6ra9a1 first appeared in SCOPe 2.07