Lineage for d1i0hb2 (1i0h B:91-205)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189807Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2189808Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2189809Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2189935Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2189960Species Escherichia coli [TaxId:562] [54722] (12 PDB entries)
  8. 2189966Domain d1i0hb2: 1i0h B:91-205 [38686]
    Other proteins in same PDB: d1i0ha1, d1i0hb1
    complexed with mn; mutant

Details for d1i0hb2

PDB Entry: 1i0h (more details), 1.35 Å

PDB Description: crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.
PDB Compounds: (B:) manganese superoxide dismutase y174f mutant

SCOPe Domain Sequences for d1i0hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0hb2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOPe Domain Coordinates for d1i0hb2:

Click to download the PDB-style file with coordinates for d1i0hb2.
(The format of our PDB-style files is described here.)

Timeline for d1i0hb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i0hb1