SCOP 1.73: Domain d1tfea_: 1tfe A:

Lineage for d1tfea_ (1tfe A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
   beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123

4. Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family)
   comprises two structural repeats of this fold

5. Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)

6. Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54717] (2 PDB entries)

8. Domain d1tfea_: 1tfe A: [38680]
   dimer of a one subdomain fragment

Details for d1tfea_

PDB Entry: 1tfe, 1.7 Å

PDB Description: dimerization domain of ef-ts from t. thermophilus

PDB Compounds: (A:) elongation factor ts

SCOP Domain Sequences for d1tfea_:

Sequence; same for both SEQRES and ATOM records:

>d1tfea_ d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus [TaxId: 274]}
aregiighyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeip
aeelekerqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliq
qaiakigenivvrrfcrfelga

Timeline for d1tfea_:

• d1tfea_ first appeared (with stable ids) in SCOP 1.55, called d1tfe__
  
• d1tfea_ was called d1tfe__ in SCOP 1.71
  
• d1tfea_ appears in SCOP 1.75
  
• d1tfea_ appears in the current release, SCOPe 2.08