Lineage for d1tfe__ (1tfe -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.43: Elongation factor Ts (EF-Ts), dimerisation domain [54712] (1 superfamily) Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) 
Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein) Protein Elongation factor Ts (EF-Ts), dimerisation domain [54715] (2 species) Species Thermus thermophilus [TaxId:274] [54717] (2 PDB entries) 
Domain d1tfe__: 1tfe - [38680]
Details for d1tfe__
PDB Entry: 1tfe (more details), 1.7 Å
PDB Description: dimerization domain of ef-ts from t. thermophilus
SCOP Domain Sequences for d1tfe__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfe__ d.43.1.1 (-) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus}
aregiighyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeip
aeelekerqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliq
qaiakigenivvrrfcrfelga
SCOP Domain Coordinates for d1tfe__:
Click to download the PDB-style file with coordinates for d1tfe__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tfe__:
- d1tfe__ appears in SCOP 1.57
- d1tfe__ appears in the current release, SCOPe 2.08, called d1tfea_
View in 3D