SCOP 1.71: Domain d1tfe__: 1tfe -

Lineage for d1tfe__ (1tfe -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
   beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123

4. Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family)
   comprises two structural repeats of this fold

5. Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)

6. Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54717] (2 PDB entries)

8. Domain d1tfe__: 1tfe - [38680]
   dimer of a one subdomain fragment

Details for d1tfe__

PDB Entry: 1tfe, 1.7 Å

PDB Description: dimerization domain of ef-ts from t. thermophilus

SCOP Domain Sequences for d1tfe__:

Sequence; same for both SEQRES and ATOM records:

>d1tfe__ d.43.1.1 (-) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus}
aregiighyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeip
aeelekerqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliq
qaiakigenivvrrfcrfelga

Timeline for d1tfe__:

• d1tfe__ first appeared (with stable ids) in SCOP 1.55
  
• d1tfe__ appears in SCOP 1.69
  
• d1tfe__ is called d1tfea_ in SCOP 1.73
  
• d1tfe__ appears in the current release, SCOPe 2.08, called d1tfea_