Lineage for d1qdvd_ (1qdv D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945738Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)
  6. 2945745Protein Kv1.2 [54708] (1 species)
  7. 2945746Species Norway rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries)
  8. 2945758Domain d1qdvd_: 1qdv D: [38655]

Details for d1qdvd_

PDB Entry: 1qdv (more details), 1.6 Å

PDB Description: n-terminal domain, voltage-gated potassium channel kv1.2 residues 33-131
PDB Compounds: (D:) kv1.2 voltage-gated potassium channel

SCOPe Domain Sequences for d1qdvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qdvd_ d.42.1.2 (D:) Kv1.2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelgeeamemfredeg

SCOPe Domain Coordinates for d1qdvd_:

Click to download the PDB-style file with coordinates for d1qdvd_.
(The format of our PDB-style files is described here.)

Timeline for d1qdvd_: