Lineage for d6k40j_ (6k40 J:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348132Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2348133Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2348189Family a.152.1.3: Atu0492-like [140970] (6 proteins)
    duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
  6. 2348232Protein automated matches [190902] (2 species)
    not a true protein
  7. 2348233Species Deinococcus radiodurans [TaxId:243230] [386098] (1 PDB entry)
  8. 2348243Domain d6k40j_: 6k40 J: [386227]
    automated match to d2oyoa1
    complexed with gol, peg, trs

Details for d6k40j_

PDB Entry: 6k40 (more details), 2.27 Å

PDB Description: crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1
PDB Compounds: (J:) Alkyl hydroperoxide reductase AhpD

SCOPe Domain Sequences for d6k40j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k40j_ a.152.1.3 (J:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
rlsflavptednahegvkklwskaeanmgfvpnvfraqalngeqflawwnyfnllvnkeg
glsnaerellavvvsglnrcvycavshgaalrefsgdavkadavavnwrqaelsereqam
cayaekltlrpaemteadlaplraaglsdeaileavqviamfnmtnrvssalgfvpnpey
hiqsr

SCOPe Domain Coordinates for d6k40j_:

Click to download the PDB-style file with coordinates for d6k40j_.
(The format of our PDB-style files is described here.)

Timeline for d6k40j_: