Class a: All alpha proteins [46456] (289 folds) |
Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
Superfamily a.152.1: AhpD-like [69118] (4 families) probable biological unit contains six domains of this fold arranged with 32 symmetry |
Family a.152.1.3: Atu0492-like [140970] (6 proteins) duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family |
Protein automated matches [190902] (2 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [386098] (1 PDB entry) |
Domain d6k40a_: 6k40 A: [386196] automated match to d2oyoa1 complexed with gol, peg, trs |
PDB Entry: 6k40 (more details), 2.27 Å
SCOPe Domain Sequences for d6k40a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k40a_ a.152.1.3 (A:) automated matches {Deinococcus radiodurans [TaxId: 243230]} prlsflavptednahegvkklwskaeanmgfvpnvfraqalngeqflawwnyfnllvnke gglsnaerellavvvsglnrcvycavshgaalrefsgdavkadavavnwrqaelsereqa mcayaekltlrpaemteadlaplraaglsdeaileavqviamfnmtnrvssalgfvpnpe yhiqsr
Timeline for d6k40a_: