Lineage for d6wvrc2 (6wvr C:246-437)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959219Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
  8. 2959614Domain d6wvrc2: 6wvr C:246-437 [386092]
    Other proteins in same PDB: d6wvra1, d6wvrb1, d6wvrc1, d6wvrd1
    automated match to d4i50a2
    complexed with gdp, gtp, mg, ta1

Details for d6wvrc2

PDB Entry: 6wvr (more details), 2.9 Å

PDB Description: tubulin dimers from a 13-protofilament, taxol stabilized microtubule
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6wvrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wvrc2 d.79.2.1 (C:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d6wvrc2:

Click to download the PDB-style file with coordinates for d6wvrc2.
(The format of our PDB-style files is described here.)

Timeline for d6wvrc2: