SCOPe 2.08: Domain d6yeha1: 6yeh A:2-175

Lineage for d6yeha1 (6yeh A:2-175)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [385968] (2 PDB entries)

8. Domain d6yeha1: 6yeh A:2-175 [386026]
   Other proteins in same PDB: d6yeha2, d6yehb2, d6yehc2, d6yehd2, d6yehe2, d6yehf2
   automated match to d3k92b1
   complexed with k, mpd

Details for d6yeha1

PDB Entry: 6yeh, 2.59 Å

PDB Description: arabidopsis thaliana glutamate dehydrogenase isoform 1 in apo form

PDB Compounds: (A:) Glutamate Dehydrogenase 1

SCOPe Domain Sequences for d6yeha1:

Sequence; same for both SEQRES and ATOM records:

>d6yeha1 c.58.1.0 (A:2-175) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nalaatnrnfklaarllgldskleksllipfreikvectipkddgtlasfvgfrvqhdna
rgpmkggiryhpevdpdevnalaqlmtwktavakipyggakggigcdpsklsiselerlt
rvftqkihdligihtdvpapdmgtgpqtmawildeyskfhgyspavvtgkpidl

Timeline for d6yeha1:

• d6yeha1 first appeared in SCOPe 2.07