Lineage for d1ffve1 (1ffv E:7-146)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1201772Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1201773Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 1201774Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 1201788Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 1201789Species Hydrogenophaga pseudoflava [TaxId:47421] [54674] (2 PDB entries)
  8. 1201791Domain d1ffve1: 1ffv E:7-146 [38592]
    Other proteins in same PDB: d1ffva1, d1ffva2, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd1, d1ffvd2, d1ffve2, d1ffvf1, d1ffvf2
    complexed with fad, fes, pcd

Details for d1ffve1

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
PDB Compounds: (E:) cutl, molybdoprotein of carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1ffve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffve1 d.41.1.1 (E:7-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
adaveavkveydelpvvidp

SCOPe Domain Coordinates for d1ffve1:

Click to download the PDB-style file with coordinates for d1ffve1.
(The format of our PDB-style files is described here.)

Timeline for d1ffve1: