Lineage for d6wt2c_ (6wt2 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569893Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2569894Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2570050Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2570051Protein automated matches [190672] (29 species)
    not a true protein
  7. 2570136Species Neisseria meningitidis [TaxId:122587] [385679] (1 PDB entry)
  8. 2570139Domain d6wt2c_: 6wt2 C: [385686]
    automated match to d3qdla_
    complexed with cl, edo, fmn, fmt, nio

Details for d6wt2c_

PDB Entry: 6wt2 (more details), 1.75 Å

PDB Description: crystal structure of putative nad(p)h-flavin oxidoreductase from neisseria meningitidis
PDB Compounds: (C:) Putative NAD(P)H-flavin oxidoreductase

SCOPe Domain Sequences for d6wt2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wt2c_ d.90.1.0 (C:) automated matches {Neisseria meningitidis [TaxId: 122587]}
mtvldreqvlsafknrkscrhydaarkisaedfqfilelgrlspssvgsepwqfvvvqnp
eirqaikpfswgmadaldtashlvvflakknarfdspfmleslkrrgvtepdamakslar
yqafqaddikilddsralfdwccrqtyialgnmmtgaamagidscpvegfnyadmervls
gqfglfdaaewgvsvaatfgyrvqeiatkarrpleetviwa

SCOPe Domain Coordinates for d6wt2c_:

Click to download the PDB-style file with coordinates for d6wt2c_.
(The format of our PDB-style files is described here.)

Timeline for d6wt2c_: