Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
Protein automated matches [190672] (29 species) not a true protein |
Species Neisseria meningitidis [TaxId:122587] [385679] (1 PDB entry) |
Domain d6wt2c_: 6wt2 C: [385686] automated match to d3qdla_ complexed with cl, edo, fmn, fmt, nio |
PDB Entry: 6wt2 (more details), 1.75 Å
SCOPe Domain Sequences for d6wt2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wt2c_ d.90.1.0 (C:) automated matches {Neisseria meningitidis [TaxId: 122587]} mtvldreqvlsafknrkscrhydaarkisaedfqfilelgrlspssvgsepwqfvvvqnp eirqaikpfswgmadaldtashlvvflakknarfdspfmleslkrrgvtepdamakslar yqafqaddikilddsralfdwccrqtyialgnmmtgaamagidscpvegfnyadmervls gqfglfdaaewgvsvaatfgyrvqeiatkarrpleetviwa
Timeline for d6wt2c_: