Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Rattus norvegicus [TaxId:10116] [385572] (1 PDB entry) |
Domain d6tu3d_: 6tu3 D: [385614] Other proteins in same PDB: d6tu3a_, d6tu3e_, d6tu3h_, d6tu3k_, d6tu3l_, d6tu3m_, d6tu3o_, d6tu3p_, d6tu3s_, d6tu3v_, d6tu3y_, d6tu3z_ automated match to d3sdie_ |
PDB Entry: 6tu3 (more details), 2.7 Å
SCOPe Domain Sequences for d6tu3d_:
Sequence, based on SEQRES records: (download)
>d6tu3d_ d.153.1.0 (D:) automated matches {Rattus norvegicus [TaxId: 10116]} sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk icalddnvcmafavvasvsgltadarivinrarvecqshrltvgdpvtveyitryiaslk qrytqsngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvreflekn ytddaietddltiklvikallevvqsggknielavmrrdqplkilspeeiekyvaeie
>d6tu3d_ d.153.1.0 (D:) automated matches {Rattus norvegicus [TaxId: 10116]} sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk icalddnvcmafagltadarivinrarvecqshrltvgdpvtveyitryiaslkqrytqs ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytddai etddltiklvikallevvqsggknielavmrrdqplkilspeeiekyvaeie
Timeline for d6tu3d_: