Lineage for d6tu3d_ (6tu3 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602722Species Rattus norvegicus [TaxId:10116] [385572] (1 PDB entry)
  8. 2602725Domain d6tu3d_: 6tu3 D: [385614]
    Other proteins in same PDB: d6tu3a_, d6tu3e_, d6tu3h_, d6tu3k_, d6tu3l_, d6tu3m_, d6tu3o_, d6tu3p_, d6tu3s_, d6tu3v_, d6tu3y_, d6tu3z_
    automated match to d3sdie_

Details for d6tu3d_

PDB Entry: 6tu3 (more details), 2.7 Å

PDB Description: rat 20s proteasome
PDB Compounds: (D:) Proteasome subunit alpha type-7

SCOPe Domain Sequences for d6tu3d_:

Sequence, based on SEQRES records: (download)

>d6tu3d_ d.153.1.0 (D:) automated matches {Rattus norvegicus [TaxId: 10116]}
sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk
icalddnvcmafavvasvsgltadarivinrarvecqshrltvgdpvtveyitryiaslk
qrytqsngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvreflekn
ytddaietddltiklvikallevvqsggknielavmrrdqplkilspeeiekyvaeie

Sequence, based on observed residues (ATOM records): (download)

>d6tu3d_ d.153.1.0 (D:) automated matches {Rattus norvegicus [TaxId: 10116]}
sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk
icalddnvcmafagltadarivinrarvecqshrltvgdpvtveyitryiaslkqrytqs
ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytddai
etddltiklvikallevvqsggknielavmrrdqplkilspeeiekyvaeie

SCOPe Domain Coordinates for d6tu3d_:

Click to download the PDB-style file with coordinates for d6tu3d_.
(The format of our PDB-style files is described here.)

Timeline for d6tu3d_: