Lineage for d6tu3a_ (6tu3 a:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2601947Species Rattus norvegicus [TaxId:10116] [385575] (1 PDB entry)
  8. 2601948Domain d6tu3a_: 6tu3 a: [385576]
    Other proteins in same PDB: d6tu3b_, d6tu3c_, d6tu3d_, d6tu3f_, d6tu3g_, d6tu3i_, d6tu3j_, d6tu3n_, d6tu3o_, d6tu3p_, d6tu3q_, d6tu3r_, d6tu3t_, d6tu3u_, d6tu3w_, d6tu3x_
    automated match to d3unfl_

Details for d6tu3a_

PDB Entry: 6tu3 (more details), 2.7 Å

PDB Description: rat 20s proteasome
PDB Compounds: (a:) Proteasome subunit beta type-1

SCOPe Domain Sequences for d6tu3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tu3a_ d.153.1.4 (a:) automated matches {Rattus norvegicus [TaxId: 10116]}
fspyafnggtvlaiagedfsivasdtrlsegfsihtrdspkcykltdktvigcsgfhgdc
ltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiegldeegkgav
ysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvpltldramrlvkdvfis
aaerdvytgdalricivtkegireetvplrkd

SCOPe Domain Coordinates for d6tu3a_:

Click to download the PDB-style file with coordinates for d6tu3a_.
(The format of our PDB-style files is described here.)

Timeline for d6tu3a_: