Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Rattus norvegicus [TaxId:10116] [385575] (1 PDB entry) |
Domain d6tu3a_: 6tu3 a: [385576] Other proteins in same PDB: d6tu3b_, d6tu3c_, d6tu3d_, d6tu3f_, d6tu3g_, d6tu3i_, d6tu3j_, d6tu3n_, d6tu3o_, d6tu3p_, d6tu3q_, d6tu3r_, d6tu3t_, d6tu3u_, d6tu3w_, d6tu3x_ automated match to d3unfl_ |
PDB Entry: 6tu3 (more details), 2.7 Å
SCOPe Domain Sequences for d6tu3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tu3a_ d.153.1.4 (a:) automated matches {Rattus norvegicus [TaxId: 10116]} fspyafnggtvlaiagedfsivasdtrlsegfsihtrdspkcykltdktvigcsgfhgdc ltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiegldeegkgav ysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvpltldramrlvkdvfis aaerdvytgdalricivtkegireetvplrkd
Timeline for d6tu3a_: