Lineage for d6krbe_ (6krb E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560188Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2560268Family d.58.10.0: automated matches [191394] (1 protein)
    not a true family
  6. 2560269Protein automated matches [190511] (8 species)
    not a true protein
  7. 2560326Species Vibrio cholerae [TaxId:345073] [385351] (1 PDB entry)
  8. 2560331Domain d6krbe_: 6krb E: [385399]
    automated match to d3trga_
    complexed with gol, so4

Details for d6krbe_

PDB Entry: 6krb (more details), 2.38 Å

PDB Description: high resolution crystal structure of an acylphosphatase protein cage
PDB Compounds: (E:) acylphosphatase

SCOPe Domain Sequences for d6krbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6krbe_ d.58.10.0 (E:) automated matches {Vibrio cholerae [TaxId: 345073]}
mekqcskfivsghvqgvgfcyhtshqglklgltgyaknlnngdvevvacgtperleelyl
wlqegpktasvrqvrrlsselehdyqgfeil

SCOPe Domain Coordinates for d6krbe_:

Click to download the PDB-style file with coordinates for d6krbe_.
(The format of our PDB-style files is described here.)

Timeline for d6krbe_: