Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) |
Family d.58.10.0: automated matches [191394] (1 protein) not a true family |
Protein automated matches [190511] (8 species) not a true protein |
Species Vibrio cholerae [TaxId:345073] [385351] (1 PDB entry) |
Domain d6krbb_: 6krb B: [385366] automated match to d3trga_ complexed with gol, so4 |
PDB Entry: 6krb (more details), 2.38 Å
SCOPe Domain Sequences for d6krbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6krbb_ d.58.10.0 (B:) automated matches {Vibrio cholerae [TaxId: 345073]} mekqcskfivsghvqgvgfcyhtshqglklgltgyaknlnngdvevvacgtperleelyl wlqegpktasvrqvrrlsselehdyqgfeil
Timeline for d6krbb_: