Lineage for d6r8ta2 (6r8t A:207-320)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402871Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2402872Protein automated matches [226946] (29 species)
    not a true protein
  7. 2402973Species Saccharolobus solfataricus [TaxId:2287] [385003] (2 PDB entries)
  8. 2402974Domain d6r8ta2: 6r8t A:207-320 [385004]
    Other proteins in same PDB: d6r8ta1, d6r8ta3
    automated match to d4m53a2
    complexed with fmt, gcp, mg, na

Details for d6r8ta2

PDB Entry: 6r8t (more details), 2.1 Å

PDB Description: crystal structure of aif2gamma subunit i181t from archaeon sulfolobus solfataricus complexed with gdpcp
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d6r8ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r8ta2 b.43.3.0 (A:207-320) automated matches {Saccharolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d6r8ta2:

Click to download the PDB-style file with coordinates for d6r8ta2.
(The format of our PDB-style files is described here.)

Timeline for d6r8ta2: