Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Saccharolobus solfataricus [TaxId:2287] [385003] (2 PDB entries) |
Domain d6r8ta2: 6r8t A:207-320 [385004] Other proteins in same PDB: d6r8ta1, d6r8ta3 automated match to d4m53a2 complexed with fmt, gcp, mg, na |
PDB Entry: 6r8t (more details), 2.1 Å
SCOPe Domain Sequences for d6r8ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6r8ta2 b.43.3.0 (A:207-320) automated matches {Saccharolobus solfataricus [TaxId: 2287]} rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad
Timeline for d6r8ta2: