Lineage for d6jmlf2 (6jml F:151-318)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2999033Species Lactobacillus casei [TaxId:1582] [56345] (4 PDB entries)
  8. 2999049Domain d6jmlf2: 6jml F:151-318 [384938]
    Other proteins in same PDB: d6jmla1, d6jmlb1, d6jmlc1, d6jmld1, d6jmle1, d6jmlf1
    automated match to d1llca2
    complexed with so4

Details for d6jmlf2

PDB Entry: 6jml (more details), 2.3 Å

PDB Description: re-refined structure of r-state l-lactate dehydrogenase fromlactobacillus casei
PDB Compounds: (F:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6jmlf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jmlf2 d.162.1.1 (F:151-318) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdafa

SCOPe Domain Coordinates for d6jmlf2:

Click to download the PDB-style file with coordinates for d6jmlf2.
(The format of our PDB-style files is described here.)

Timeline for d6jmlf2: