SCOPe 2.07: Domain d6wlcb2: 6wlc B:192-347

Lineage for d6wlcb2 (6wlc B:192-347)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins)
   PfamB PB001946

6. Protein automated matches [384919] (1 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [384920] (27 PDB entries)

8. Domain d6wlcb2: 6wlc B:192-347 [384928]
   Other proteins in same PDB: d6wlca1, d6wlcb1
   automated match to d2h85a2
   complexed with act, edo, fmt, so4, trs, u5p

Details for d6wlcb2

PDB Entry: 6wlc, 1.82 Å

PDB Description: crystal structure of nsp15 endoribonuclease from sars cov-2 in the complex with uridine-5'-monophosphate

PDB Compounds: (B:) Nsp15

SCOPe Domain Sequences for d6wlcb2:

Sequence; same for both SEQRES and ATOM records:

>d6wlcb2 d.294.1.2 (B:192-347) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl
liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsvvskvvkvtidyteisfmlwckdghvetfypklq

Timeline for d6wlcb2:

• d6wlcb2 is new in SCOPe 2.07-stable
  
• d6wlcb2 appears in the current release, SCOPe 2.08