SCOPe 2.05: Domain d1frob_: 1fro B:

Lineage for d1frob_ (1fro B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold

6. Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54596] (4 PDB entries)

8. Domain d1frob_: 1fro B: [38481]
   complexed with gsb, zn

Details for d1frob_

PDB Entry: 1fro, 2.2 Å

PDB Description: human glyoxalase i with benzyl-glutathione inhibitor

PDB Compounds: (B:) lactoylglutathione lyase

SCOPe Domain Sequences for d1frob_:

Sequence; same for both SEQRES and ATOM records:

>d1frob_ d.32.1.1 (B:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]}
ggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcdfpimkf
slyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfghi
giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmatlm

Timeline for d1frob_:

• d1frob_ first appeared (with stable ids) in SCOP 1.55
  
• d1frob_ appears in SCOPe 2.04
  
• d1frob_ appears in SCOPe 2.06
  
• d1frob_ appears in the current release, SCOPe 2.08