Lineage for d5qpga_ (5qpg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731887Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2731888Protein automated matches [196409] (46 species)
    not a true protein
  7. 2732151Species Trypanosoma cruzi [TaxId:5693] [196823] (68 PDB entries)
  8. 2732179Domain d5qpga_: 5qpg A: [384762]
    automated match to d1yhla_
    complexed with act, awv, so4, zn

Details for d5qpga_

PDB Entry: 5qpg (more details), 1.58 Å

PDB Description: pandda analysis group deposition -- crystal structure of t. cruzi fpps in complex with fmopl000291a
PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d5qpga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qpga_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
dpevaqpmttdfaeftpaiykrivkykttfytyllplvmgllvseaaasvemnlvervah
ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygek
dpakvavvkrlyskanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr

SCOPe Domain Coordinates for d5qpga_:

Click to download the PDB-style file with coordinates for d5qpga_.
(The format of our PDB-style files is described here.)

Timeline for d5qpga_: