Lineage for d1d7ja_ (1d7j A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408349Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1408360Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 1408364Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)
  8. 1408378Domain d1d7ja_: 1d7j A: [38389]
    complexed with buq, nh4, so4

Details for d1d7ja_

PDB Entry: 1d7j (more details), 1.85 Å

PDB Description: fkbp complexed with 4-hydroxy-2-butanone
PDB Compounds: (A:) protein (fk506-binding protein)

SCOPe Domain Sequences for d1d7ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7ja_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d1d7ja_:

Click to download the PDB-style file with coordinates for d1d7ja_.
(The format of our PDB-style files is described here.)

Timeline for d1d7ja_: