SCOPe 2.04: Domain d1d7ja_: 1d7j A:

Lineage for d1d7ja_ (1d7j A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)

8. Domain d1d7ja_: 1d7j A: [38389]
   complexed with buq, nh4, so4

Details for d1d7ja_

PDB Entry: 1d7j, 1.85 Å

PDB Description: fkbp complexed with 4-hydroxy-2-butanone

PDB Compounds: (A:) protein (fk506-binding protein)

SCOPe Domain Sequences for d1d7ja_:

Sequence; same for both SEQRES and ATOM records:

>d1d7ja_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d1d7ja_:

• d1d7ja_ first appeared (with stable ids) in SCOP 1.55
  
• d1d7ja_ appears in SCOPe 2.03
  
• d1d7ja_ appears in SCOPe 2.05
  
• d1d7ja_ appears in the current release, SCOPe 2.08