Lineage for d1dzoa_ (1dzo A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1022488Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 1022489Superfamily d.24.1: Pili subunits [54523] (7 families) (S)
    bacterial filament proteins
  5. 1022490Family d.24.1.1: Pilin [54524] (5 proteins)
  6. 1022502Protein Type IV Pilin Pak [109620] (1 species)
  7. 1022503Species Pseudomonas aeruginosa [TaxId:287] [54527] (3 PDB entries)
  8. 1022505Domain d1dzoa_: 1dzo A: [38378]

Details for d1dzoa_

PDB Entry: 1dzo (more details), 1.63 Å

PDB Description: truncated pak pilin from pseudomonas aeruginosa
PDB Compounds: (A:) type IV pilin

SCOPe Domain Sequences for d1dzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzoa_ d.24.1.1 (A:) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]}
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

SCOPe Domain Coordinates for d1dzoa_:

Click to download the PDB-style file with coordinates for d1dzoa_.
(The format of our PDB-style files is described here.)

Timeline for d1dzoa_: