SCOPe 2.03: Domain d1qo3a2: 1qo3 A:2-181

Lineage for d1qo3a2 (1qo3 A:2-181)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (20 PDB entries)

8. Domain d1qo3a2: 1qo3 A:2-181 [38310]
   Other proteins in same PDB: d1qo3a1, d1qo3b_, d1qo3c_, d1qo3d_
   complexed with edo

Details for d1qo3a2

PDB Entry: 1qo3, 2.3 Å

PDB Description: complex between nk cell receptor ly49a and its mhc class i ligand h-2dd

PDB Compounds: (A:) MHC class I h-2dd heavy chain

SCOPe Domain Sequences for d1qo3a2:

Sequence; same for both SEQRES and ATOM records:

>d1qo3a2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe
retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc
dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr

Timeline for d1qo3a2:

• d1qo3a2 first appeared (with stable ids) in SCOP 1.55
  
• d1qo3a2 appears in SCOPe 2.02
  
• d1qo3a2 appears in SCOPe 2.04
  
• d1qo3a2 appears in the current release, SCOPe 2.08