Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (20 PDB entries) |
Domain d1qo3a2: 1qo3 A:2-181 [38310] Other proteins in same PDB: d1qo3a1, d1qo3b_, d1qo3c_, d1qo3d_ complexed with edo |
PDB Entry: 1qo3 (more details), 2.3 Å
SCOPe Domain Sequences for d1qo3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qo3a2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]} shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr
Timeline for d1qo3a2: