Lineage for d1qo3d_ (1qo3 D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442798Protein NK cell receptor [56452] (3 species)
  7. 1442799Species Mouse (Mus musculus), ly49-a [TaxId:10090] [56453] (1 PDB entry)
  8. 1442801Domain d1qo3d_: 1qo3 D: [42351]
    Other proteins in same PDB: d1qo3a1, d1qo3a2, d1qo3b_
    complexed with edo

Details for d1qo3d_

PDB Entry: 1qo3 (more details), 2.3 Å

PDB Description: complex between nk cell receptor ly49a and its mhc class i ligand h-2dd
PDB Compounds: (D:) ly49a

SCOPe Domain Sequences for d1qo3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo3d_ d.169.1.1 (D:) NK cell receptor {Mouse (Mus musculus), ly49-a [TaxId: 10090]}
dkvywfcygmkcyyfvmdrktwsgckqtcqssslsllkiddedelkflqlvvpsdscwvg
lsydnkkkdwawidnrpsklalntrkynirdggcmllsktrldngncdqvficicgkrld
k

SCOPe Domain Coordinates for d1qo3d_:

Click to download the PDB-style file with coordinates for d1qo3d_.
(The format of our PDB-style files is described here.)

Timeline for d1qo3d_: