Lineage for d1i1fd2 (1i1f D:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2182718Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (101 PDB entries)
    Uniprot P01892 25-298
  8. 2182876Domain d1i1fd2: 1i1f D:1-181 [38254]
    Other proteins in same PDB: d1i1fa1, d1i1fb2, d1i1fb3, d1i1fd1, d1i1fe2, d1i1fe3

Details for d1i1fd2

PDB Entry: 1i1f (more details), 2.8 Å

PDB Description: crystal structure of human class i mhc (hla-a2.1) complexed with beta 2-microglobulin and hiv-rt variant peptide i1y
PDB Compounds: (D:) protein (class I histocompatibility antigen, gogo-a0201 alpha chain)

SCOPe Domain Sequences for d1i1fd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1fd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1i1fd2:

Click to download the PDB-style file with coordinates for d1i1fd2.
(The format of our PDB-style files is described here.)

Timeline for d1i1fd2: