Lineage for d1iebd2 (1ieb D:4-92)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255507Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (7 PDB entries)
  8. 255535Domain d1iebd2: 1ieb D:4-92 [38212]
    Other proteins in same PDB: d1ieba1, d1iebb1, d1iebc1, d1iebd1
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag, so4

Details for d1iebd2

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1iebd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iebd2 d.19.1.1 (D:4-92) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

SCOP Domain Coordinates for d1iebd2:

Click to download the PDB-style file with coordinates for d1iebd2.
(The format of our PDB-style files is described here.)

Timeline for d1iebd2: