![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
![]() | Species Mouse (Mus musculus), I-EK [TaxId:10090] [49139] (7 PDB entries) |
![]() | Domain d1iebc1: 1ieb C:82-182 [21637] Other proteins in same PDB: d1ieba2, d1iebb2, d1iebc2, d1iebd2 |
PDB Entry: 1ieb (more details), 2.7 Å
SCOP Domain Sequences for d1iebc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iebc1 b.1.1.2 (C:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK} danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee
Timeline for d1iebc1: