Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) |
Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (10 species) |
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [54461] (3 PDB entries) |
Domain d1hqrb2: 1hqr B:202-292 [38188] Other proteins in same PDB: d1hqra1, d1hqrb1, d1hqrd1, d1hqrd2 |
PDB Entry: 1hqr (more details), 3.2 Å
SCOP Domain Sequences for d1hqrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqrb2 d.19.1.1 (B:202-292) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2} dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw nsqkdfledrraavdtycrhnygvgesftvq
Timeline for d1hqrb2:
View in 3D Domains from other chains: (mouse over for more information) d1hqra1, d1hqra2, d1hqrd1, d1hqrd2 |