Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species) |
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [54461] (3 PDB entries) |
Domain d1bx2b2: 1bx2 B:3-92 [38184] Other proteins in same PDB: d1bx2a1, d1bx2b1, d1bx2d1, d1bx2e1 |
PDB Entry: 1bx2 (more details), 2.6 Å
SCOP Domain Sequences for d1bx2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bx2b2 d.19.1.1 (B:3-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2} trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn sqkdileqaraavdtycrhnygvvesftvq
Timeline for d1bx2b2: