Lineage for d1bx2b1 (1bx2 B:93-193)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220734Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 220776Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [49135] (3 PDB entries)
  8. 220782Domain d1bx2b1: 1bx2 B:93-193 [21610]
    Other proteins in same PDB: d1bx2a2, d1bx2b2, d1bx2d2, d1bx2e2

Details for d1bx2b1

PDB Entry: 1bx2 (more details), 2.6 Å

PDB Description: crystal structure of hla-dr2 (dra*0101,drb1*1501) complexed with a peptide from human myelin basic protein

SCOP Domain Sequences for d1bx2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx2b1 b.1.1.2 (B:93-193) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
rrvqpkvtvypsktqplqhhnllvcsvsgfypgsievrwflngqeekagmvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrarse

SCOP Domain Coordinates for d1bx2b1:

Click to download the PDB-style file with coordinates for d1bx2b1.
(The format of our PDB-style files is described here.)

Timeline for d1bx2b1: