![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries) Uniprot P04229 30-219 |
![]() | Domain d1fv1b2: 1fv1 B:1-92 [38180] Other proteins in same PDB: d1fv1a1, d1fv1a2, d1fv1b1, d1fv1d1, d1fv1d2, d1fv1e1 complexed with gol, so4 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1fv1 (more details), 1.9 Å
SCOPe Domain Sequences for d1fv1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fv1b2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} gdtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaey wnsqkdfledrraavdtycrhnygvgesftvq
Timeline for d1fv1b2: