Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) has an additional strand at the C-terminus and a helix inserted after the first strand |
Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
Protein Uracil-DNA glycosylase inhibitor protein [54443] (3 species) |
Species Bacteriophage pbs2 [TaxId:10684] [54445] (12 PDB entries) |
Domain d2ugib_: 2ugi B: [38135] protein/DNA complex; complexed with imd |
PDB Entry: 2ugi (more details), 2.2 Å
SCOPe Domain Sequences for d2ugib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ugib_ d.17.5.1 (B:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]} tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd apeykpwalviqdsngenkikml
Timeline for d2ugib_: