Lineage for d1ndof_ (1ndo F:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326290Fold d.17: Cystatin-like [54402] (6 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 326465Superfamily d.17.4: NTF2-like [54427] (8 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 326577Family d.17.4.4: Naphthalene 1,2-dioxygenase beta subunit [54438] (1 protein)
  6. 326578Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species)
  7. 326579Species Pseudomonas putida [TaxId:303] [54440] (8 PDB entries)
  8. 326589Domain d1ndof_: 1ndo F: [38123]
    Other proteins in same PDB: d1ndoa1, d1ndoa2, d1ndoc1, d1ndoc2, d1ndoe1, d1ndoe2
    complexed with fe, fes

Details for d1ndof_

PDB Entry: 1ndo (more details), 2.25 Å

PDB Description: napthalene 1,2-dioxygenase

SCOP Domain Sequences for d1ndof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndof_ d.17.4.4 (F:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

SCOP Domain Coordinates for d1ndof_:

Click to download the PDB-style file with coordinates for d1ndof_.
(The format of our PDB-style files is described here.)

Timeline for d1ndof_: