SCOPe 2.02: Domain d1buqa_: 1buq A:

Lineage for d1buqa_ (1buq A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)

7. Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (20 PDB entries)

8. Domain d1buqa_: 1buq A: [38111]
   complexed with nth

Details for d1buqa_

PDB Entry: 1buq

PDB Description: solution structure of delta-5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone-hemisuccinate

PDB Compounds: (A:) protein (3-ketosteroid isomerase-19-nortestosterone-hemisuccinate)

SCOPe Domain Sequences for d1buqa_:

Sequence; same for both SEQRES and ATOM records:

>d1buqa_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatvedpvgseprsgtaaireffanslk
lplaveltqevravaneaafaftvsfefqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

Timeline for d1buqa_:

• d1buqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1buqa_ appears in SCOPe 2.01
  
• d1buqa_ appears in SCOPe 2.03
  
• d1buqa_ appears in the current release, SCOPe 2.08