Lineage for d6rvna2 (6rvn A:209-315)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2566676Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2566677Protein automated matches [226843] (8 species)
    not a true protein
  7. 2566700Species Staphylococcus aureus [TaxId:1280] [327472] (9 PDB entries)
  8. 2566703Domain d6rvna2: 6rvn A:209-315 [381081]
    Other proteins in same PDB: d6rvna1, d6rvna3
    automated match to d4m8ia2
    complexed with ca, gdp

Details for d6rvna2

PDB Entry: 6rvn (more details), 1.24 Å

PDB Description: aftsz-gdp-wat
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d6rvna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rvna2 d.79.2.0 (A:209-315) automated matches {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d6rvna2:

Click to download the PDB-style file with coordinates for d6rvna2.
(The format of our PDB-style files is described here.)

Timeline for d6rvna2: