Lineage for d1qjgb_ (1qjg B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1197160Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1197250Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)
  6. 1197251Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 1197252Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (20 PDB entries)
  8. 1197288Domain d1qjgb_: 1qjg B: [38103]
    complexed with equ, so4

Details for d1qjgb_

PDB Entry: 1qjg (more details), 2.3 Å

PDB Description: crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni in complex with equilenin
PDB Compounds: (B:) Ketosteroid Isomerase

SCOPe Domain Sequences for d1qjgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjgb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

SCOPe Domain Coordinates for d1qjgb_:

Click to download the PDB-style file with coordinates for d1qjgb_.
(The format of our PDB-style files is described here.)

Timeline for d1qjgb_: