SCOPe 2.08: Domain d6o1ha_: 6o1h A:

Lineage for d6o1ha_ (6o1h A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein Trp synthase alpha-subunit [51388] (9 species)

7. Species Salmonella typhimurium [TaxId:90371] [51389] (72 PDB entries)

8. Domain d6o1ha_: 6o1h A: [380751]
   Other proteins in same PDB: d6o1hb_
   automated match to d1k8ya_
   complexed with 1d0, cl, cs, dms, f9f, hvk; mutant

Details for d6o1ha_

PDB Entry: 6o1h, 1.64 Å

PDB Description: tryptophan synthase q114a mutant in complex with n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9f) at the enzyme alpha-site, cesium ion at the metal coordination site, and 2-aminophenol quinonoid at the enzyme beta site

PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d6o1ha_:

Sequence; same for both SEQRES and ATOM records:

>d6o1ha_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra

Timeline for d6o1ha_:

• d6o1ha_ first appeared in SCOPe 2.07