Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
Protein Trp synthase alpha-subunit [51388] (9 species) |
Species Salmonella typhimurium [TaxId:90371] [51389] (72 PDB entries) |
Domain d6o1ha_: 6o1h A: [380751] Other proteins in same PDB: d6o1hb_ automated match to d1k8ya_ complexed with 1d0, cl, cs, dms, f9f, hvk; mutant |
PDB Entry: 6o1h (more details), 1.64 Å
SCOPe Domain Sequences for d6o1ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o1ha_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki ieknlaspkqmlaelrsfvsamkaasra
Timeline for d6o1ha_: