SCOPe 2.07: Domain d5qu62_: 5qu6 2:

Lineage for d5qu62_ (5qu6 2:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)

8. Domain d5qu62_: 5qu6 2: [380519]
   Other proteins in same PDB: d5qu6e2, d5qu6k2, d5qu6l2, d5qu6o2
   automated match to d5hcka_

Details for d5qu62_

PDB Entry: 5qu6, 1.82 Å

PDB Description: crystal structure of swapped human nck sh3.1 domain, 1.8a, triclinic

PDB Compounds: (2:) cytoplasmic protein nck1

SCOPe Domain Sequences for d5qu62_:

Sequence, based on SEQRES records:

>d5qu62_ b.34.2.0 (2:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyv

Sequence, based on observed residues (ATOM records):

>d5qu62_ b.34.2.0 (2:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvvvakfdyldikknerlwllddskswwrvrnsmnktgfvpsnyv

Timeline for d5qu62_:

• d5qu62_ is new in SCOPe 2.07-stable
  
• d5qu62_ appears in the current release, SCOPe 2.08