Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries) |
Domain d5qu6e1: 5qu6 E:2-59 [380515] Other proteins in same PDB: d5qu6e2, d5qu6k2, d5qu6l2, d5qu6o2 automated match to d5hcka_ |
PDB Entry: 5qu6 (more details), 1.82 Å
SCOPe Domain Sequences for d5qu6e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5qu6e1 b.34.2.0 (E:2-59) automated matches {Human (Homo sapiens) [TaxId: 9606]} maeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
Timeline for d5qu6e1:
View in 3D Domains from other chains: (mouse over for more information) d5qu61_, d5qu62_, d5qu6a_, d5qu6b_, d5qu6c_, d5qu6d_, d5qu6f_, d5qu6g_, d5qu6h_, d5qu6i_, d5qu6j_, d5qu6k1, d5qu6k2, d5qu6l1, d5qu6l2, d5qu6m_, d5qu6n_, d5qu6o1, d5qu6o2, d5qu6p_, d5qu6q_, d5qu6r_, d5qu6s_, d5qu6t_, d5qu6u_, d5qu6v_, d5qu6w_, d5qu6x_, d5qu6y_, d5qu6z_ |