Lineage for d5qu6e1 (5qu6 E:2-59)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392985Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2392986Protein automated matches [190457] (10 species)
    not a true protein
  7. 2393062Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)
  8. 2393111Domain d5qu6e1: 5qu6 E:2-59 [380515]
    Other proteins in same PDB: d5qu6e2, d5qu6k2, d5qu6l2, d5qu6o2
    automated match to d5hcka_

Details for d5qu6e1

PDB Entry: 5qu6 (more details), 1.82 Å

PDB Description: crystal structure of swapped human nck sh3.1 domain, 1.8a, triclinic
PDB Compounds: (E:) cytoplasmic protein nck1

SCOPe Domain Sequences for d5qu6e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qu6e1 b.34.2.0 (E:2-59) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver

SCOPe Domain Coordinates for d5qu6e1:

Click to download the PDB-style file with coordinates for d5qu6e1.
(The format of our PDB-style files is described here.)

Timeline for d5qu6e1: