Class b: All beta proteins [48724] (178 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
Protein automated matches [254496] (16 species) not a true protein |
Species Haemophilus influenzae [TaxId:71421] [268355] (10 PDB entries) |
Domain d6ojha3: 6ojh A:331-445 [380435] Other proteins in same PDB: d6ojha1, d6ojha2 automated match to d2w6za3 complexed with act, ca, mv4 |
PDB Entry: 6ojh (more details), 2.05 Å
SCOPe Domain Sequences for d6ojha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ojha3 b.84.2.0 (A:331-445) automated matches {Haemophilus influenzae [TaxId: 71421]} kghamecrinaedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklit ygdtrevairrmqnalsetiidgiktniplheliledenfqkggtnihylekklg
Timeline for d6ojha3: