Lineage for d6ojha3 (6ojh A:331-445)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426884Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2427009Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2427010Protein automated matches [254496] (16 species)
    not a true protein
  7. 2427039Species Haemophilus influenzae [TaxId:71421] [268355] (10 PDB entries)
  8. 2427047Domain d6ojha3: 6ojh A:331-445 [380435]
    Other proteins in same PDB: d6ojha1, d6ojha2
    automated match to d2w6za3
    complexed with act, ca, mv4

Details for d6ojha3

PDB Entry: 6ojh (more details), 2.05 Å

PDB Description: crystal structure of haemophilus influenzae biotin carboxylase complexed with (r)-7-(3-aminopyrrolidin-1-yl)-6-(naphthalen-1-yl) pyrido[2,3-d]pyrimidin-2-amine
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d6ojha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ojha3 b.84.2.0 (A:331-445) automated matches {Haemophilus influenzae [TaxId: 71421]}
kghamecrinaedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklit
ygdtrevairrmqnalsetiidgiktniplheliledenfqkggtnihylekklg

SCOPe Domain Coordinates for d6ojha3:

Click to download the PDB-style file with coordinates for d6ojha3.
(The format of our PDB-style files is described here.)

Timeline for d6ojha3: